PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB09G18680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 383aa    MW: 41026 Da    PI: 9.1475
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB09G18680.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox34.63.2e-11181235256
                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rq  vW q rRa+ k
  OB09G18680.1 181 RKKLRLSKEQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQGEVWSQTRRARTK 235
                   788899***********************************************98 PP

2HD-ZIP_I/II111.36.3e-36181271192
   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                   +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prq +vW q rRARtk+kq+E+d+e+Lkr++++l+ee++rL+ke +eLr +lk
  OB09G18680.1 181 RKKLRLSKEQSAFLEESFKEHSTLNPKQKLALAKQLNLRPRQGEVWSQTRRARTKLKQTEVDCEYLKRCCETLAEETRRLQKELAELR-ALK 271
                   69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-11169236IPR009057Homeodomain-like
SuperFamilySSF466895.13E-12169238IPR009057Homeodomain-like
PROSITE profilePS5007113.507177237IPR001356Homeobox domain
SMARTSM003891.8E-6179241IPR001356Homeobox domain
CDDcd000864.81E-10181238No hitNo description
PfamPF000469.7E-9181235IPR001356Homeobox domain
SMARTSM003403.9E-22237280IPR003106Leucine zipper, homeobox-associated
PfamPF021831.9E-9237271IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MELGLSLGEA AMPDAGRELV LGLGVGVGVV GVGVGVGVGV RTEERAAESG RRELGFGSSR  60
CGSSPEPTVR LTLLPMVPGL GLPWPSSSES RGHLEASTRG FDVNRPPSSG GGYGAAEEEQ  120
DDAAGAALSS SPNNSAGSFP MDDYSGQGRG GNDSAPGAGG AGGGDRSCSR ASAEDDGGSA  180
RKKLRLSKEQ SAFLEESFKE HSTLNPKQKL ALAKQLNLRP RQGEVWSQTR RARTKLKQTE  240
VDCEYLKRCC ETLAEETRRL QKELAELRAL KTVHPFYMHL PATTLSMCPS CERVASNSAP  300
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXRRR SRPQAVVLRR PVLVGTQLTV  360
IRSTAGAAAD ELVTRKLRRG TCL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1229237RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0364471e-153BT036447.1 Zea mays full-length cDNA clone ZM_BFb0114O05 mRNA, complete cds.
GenBankKJ7269111e-153KJ726911.1 Zea mays clone pUT3456 HB transcription factor (HB11) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015696371.10.0PREDICTED: homeobox-leucine zipper protein HOX11
SwissprotQ67UE21e-138HOX11_ORYSJ; Homeobox-leucine zipper protein HOX11
TrEMBLJ3MXY90.0J3MXY9_ORYBR; Uncharacterized protein
STRINGOB09G18680.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52093363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.19e-57homeobox from Arabidopsis thaliana